Antibody data

Product number
H00001208-M07
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001208-M07, RRID:AB_1136915
Product name
CLPS monoclonal antibody (M07), clone 1G5
Provider product page
Abnova Corporation - H00001208-M07
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant CLPS.
Antigen sequence
MEKILILLLVALSVAYAAPGPRGIIINLENGELCM
NSAQCKSNCCQHSSALGLARCTSMASENSECSVKT
LYGIYYKCPCERGLTCEGDKTIVGSITNTNFGICH
DAGRSKQ
Isotype
IgG
Antibody clone number
1G5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -