Antibody data
- Antibody Data
 - Antigen structure
 - References [0]
 - Comments [0]
 - Validations
 - Western blot [2]
 
Submit
Validation data
Reference
Comment
Report error
- Product number
 - H00001208-B01P - Provider product page

 - Provider
 - Abnova Corporation
 - Proper citation
 - Abnova Corporation Cat#H00001208-B01P, RRID:AB_1573076
 - Product name
 - CLPS purified MaxPab mouse polyclonal antibody (B01P)
 - Antibody type
 - Polyclonal
 - Description
 - Mouse polyclonal antibody raised against a full-length human CLPS protein.
 - Antigen sequence
 MEKILILLLVALSVAYAAPGPRGIIINLENGELCM
NSAQCKSNCCQHSSALGLARCTSMASENSECSVKT
LYGIYYKCPCERGLTCEGDKTIVGSITNTNFGICH
DAGRSKQ- Storage
 - Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
 
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
		- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Western Blot analysis of CLPS expression in transfected 293T cell line (H00001208-T01) by CLPS MaxPab polyclonal antibody.Lane 1: CLPS transfected lysate(12.32 KDa).Lane 2: Non-transfected lysate.
 
- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - CLPS MaxPab polyclonal antibody. Western Blot analysis of CLPS expression in human pancreas.