Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001208-D01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001208-D01, RRID:AB_10721235
- Product name
- CLPS MaxPab rabbit polyclonal antibody (D01)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human CLPS protein.
- Antigen sequence
MEKILILLLVALSVAYAAPGPRGIIINLENGELCM
NSAQCKSNCCQHSSALGLARCTSMASENSECSVKT
LYGIYYKCPCERGLTCEGDKTIVGSITNTNFGICH
DAGRSKQ- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CLPS MaxPab rabbit polyclonal antibody. Western Blot analysis of CLPS expression in human pancreas.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CLPS expression in transfected 293T cell line (H00001208-T01) by CLPS MaxPab polyclonal antibody.Lane 1: CLPS transfected lysate(12 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of CLPS transfected lysate using anti-CLPS MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CLPS MaxPab mouse polyclonal antibody (B01) (H00001208-B01).
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol