HPA010948

DPYSL3 antibody from Sigma-Aldrich
CRMP4, DRP-3, ULIP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010948
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010948, RRID:AB_1847245
Product name
Anti-DPYSL3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010948
Antibody type
Polyclonal
Antigen
Dihydropyrimidinase-related protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IIDHVVPEPESSLTEAYEKWREWADGKSCCDYALH
VDITHWNDSVKQEVQNLIKDKGVNSFMVYMAYKDL
YQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQE
QTRMLEMGITGPE
Storage
-20C
Provider Type Product Number
- No reagents -