HPA025936
UTP6 antibody from Atlas Antibodies
C17orf40, HCA66
Validated within the Antibodypedia Validation Initative
Antibody data
- Product number
- HPA025936
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA025936, RRID:AB_1845588
- Product name
- Anti-UTP6
- Provider product page
- Atlas Antibodies - HPA025936
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ARQLFLRALRFHPECPKLYKEYFRMELMHAEKLRK
EKEEFEKASMDVENPDYSEEILKGELAWIIYKNSV
SIIKGAEFHVSLLSIAQLFDFAKDLQKEIYDDLQA
LHTDDPLTWDYVARRELEIESQTEEQPTTKQAKAV
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Enhanced validation
- Submitted by
-
klas2
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot of cell lysate from U-2 OS cells transfected with either siRNA targeting UTP6 or control siRNA.
Lane 1: Marker (250, 130, 95, 72, 55, 36, 28, 17, 10)
Lane 2: Cell lysate from U-2OS cells transfected with siRNA targeting UTP6
Lane 3: N/A
Lane 4: Cell lysate from U-2OS cells transfected with control siRNA
Right image, lane 1-4: loading control
- Sample type
- U-2 OS
- Primary Ab dilution
- 1:86
- Conjugate
- Horseradish Peroxidase
- Secondary Ab
- Secondary Ab
- Secondary Ab dilution
- 1:3000
- Knockdown/Genetic Approaches Application
- Western blot
- KD Reagent Type
- siRNA
- Downregulation
- >75%
- KD Reagent Provider
- Thermo Fisher Scientific
- KD Reagent Prod no
- s31576
- KD Reagent Prod page
- KD Reagent Prod page
- KD Reagent Prod no 2
- s31574
- KD Reagent Page 2
- KD Reagent Page 2
- KD Reagent Prod no 3
- s31575
- KD Reagent Page 3
- KD Reagent Page 3
- Antibody Lot Number
- R12435
- Appendix
- 560d0f3240e78.pdf
- Show more
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-UTP6 antibody. Remaining relative intensity is presented.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to nucleoli.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human hippocampus shows strong nucleolar positivity in neuronal cells.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows trong positivity in nucleoli.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows strong positivity in nucleoli in epidermal cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows strong positivity in nucleoli in lymphoid cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows strong to strong positivity in nucleoli in hepatocytes.
- Sample type
- HUMAN
Enhanced validation
Supportive data in Antibodypedia
