HPA007340

GALE antibody from Sigma-Aldrich
SDR1E1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007340
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007340, RRID:AB_1078934
Product name
Anti-GALE antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007340
Antibody type
Polyclonal
Antigen
UDP-glucose 4-epimerase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGT
GVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGT
GTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAA
Storage
-20C
Provider Type Product Number
- No reagents -