Antibody data

Product number
H00010963-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010963-M02, RRID:AB_11189535
Product name
STIP1 monoclonal antibody (M02), clone 1B10
Provider product page
Abnova Corporation - H00010963-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant STIP1.
Antigen sequence
TKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRH
DSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKD
PQALSEHLKNPVIAQKIQKLMDVGLIAIR
Isotype
IgG
Antibody clone number
1B10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -