Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010963-M11 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010963-M11, RRID:AB_566210
- Product name
- STIP1 monoclonal antibody (M11), clone 1E3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant STIP1.
- Antigen sequence
TKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRH
DSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKD
PQALSEHLKNPVIAQKIQKLMDVGLIAIR- Isotype
- IgG
- Antibody clone number
- 1E3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Glaucoma-associated WDR36 variants encode functional defects in a yeast model system.
Footz TK, Johnson JL, Dubois S, Boivin N, Raymond V, Walter MA
Human molecular genetics 2009 Apr 1;18(7):1276-87
Human molecular genetics 2009 Apr 1;18(7):1276-87
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- STIP1 monoclonal antibody (M11), clone 1E3. Western Blot analysis of STIP1 expression in Raw 264.7 ( Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged STIP1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to STIP1 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
