Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010963-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010963-M01, RRID:AB_607106
- Product name
- STIP1 monoclonal antibody (M01), clone 4B6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant STIP1.
- Antigen sequence
MEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDP
HNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPD
WGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANN
PQLKEGLQNMEARLAERKFMNPFNMPNLYQKLESD
PRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRI
MTTLSVLLGVDLGSMDEEEEIATPPPPPPPKKETK
PEPMEEDLPENKKQALKEKELGNDAYKKKDFDTAL
KHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRE
LCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEK
YKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQE
RLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTE
AIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEEC
IQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKAL
DLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAM
ADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNP
VIAQKIQKLMDVGLIAIR- Isotype
- IgG
- Antibody clone number
- 4B6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Stress-induced phosphoprotein 1 as a secreted biomarker for human ovarian cancer promotes cancer cell proliferation.
Proteomic analysis of protein complexes in human SH-SY5Y neuroblastoma cells by using blue-native gel electrophoresis: an increase in lamin A/C associated with heat shock protein 90 in response to 6-hydroxydopamine-induced oxidative stress.
Novel breast cancer metastasis-associated proteins.
Wang TH, Chao A, Tsai CL, Chang CL, Chen SH, Lee YS, Chen JK, Lin YJ, Chang PY, Wang CJ, Chao AS, Chang SD, Chang TC, Lai CH, Wang HS
Molecular & cellular proteomics : MCP 2010 Sep;9(9):1873-84
Molecular & cellular proteomics : MCP 2010 Sep;9(9):1873-84
Proteomic analysis of protein complexes in human SH-SY5Y neuroblastoma cells by using blue-native gel electrophoresis: an increase in lamin A/C associated with heat shock protein 90 in response to 6-hydroxydopamine-induced oxidative stress.
Nakamura M, Morisawa H, Imajoh-Ohmi S, Takamura C, Fukuda H, Toda T
Experimental gerontology 2009 Jun-Jul;44(6-7):375-82
Experimental gerontology 2009 Jun-Jul;44(6-7):375-82
Novel breast cancer metastasis-associated proteins.
Ho J, Kong JW, Choong LY, Loh MC, Toy W, Chong PK, Wong CH, Wong CY, Shah N, Lim YP
Journal of proteome research 2009 Feb;8(2):583-94
Journal of proteome research 2009 Feb;8(2):583-94
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- STIP1 monoclonal antibody (M01), clone 4B6 Western Blot analysis of STIP1 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of STIP1 expression in transfected 293T cell line by STIP1 monoclonal antibody (M01), clone 4B6.Lane 1: STIP1 transfected lysate(62.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged STIP1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of STIP1 transfected lysate using anti-STIP1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with STIP1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to STIP1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 0.3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol