Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
- Flow cytometry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010963-M35 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010963-M35, RRID:AB_10718570
- Product name
- STIP1 monoclonal antibody (M35), clone 2E11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant STIP1.
- Antigen sequence
MEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDP
HNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPD
WGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANN
PQLKEGLQNMEARLAERKFMNPFNMPNLYQKLESD
PRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRI
MTTLSVLLGVDLGSMDEEEEIATPPPPPPPKKETK
PEPMEEDLPENKKQALKEKELGNDAYKKKDFDTAL
KHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRE
LCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEK
YKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQE
RLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTE
AIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEEC
IQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKAL
DLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAM
ADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNP
VIAQKIQKLMDVGLIAIR- Isotype
- IgG
- Antibody clone number
- 2E11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Tumor stress-induced phosphoprotein1 (STIP1) as a prognostic biomarker in ovarian cancer.
Immunohistological analysis of stress-induced phosphoprotein 1 in ovarian cancer patients with low serum cancer antigen 125 levels.
Stress-induced phosphoprotein 1 as a secreted biomarker for human ovarian cancer promotes cancer cell proliferation.
Chao A, Lai CH, Tsai CL, Hsueh S, Hsueh C, Lin CY, Chou HH, Lin YJ, Chen HW, Chang TC, Wang TH
PloS one 2013;8(2):e57084
PloS one 2013;8(2):e57084
Immunohistological analysis of stress-induced phosphoprotein 1 in ovarian cancer patients with low serum cancer antigen 125 levels.
Chao A, Lee LY, Hsueh C, Lin CY, Tsai CL, Chao AS, Lin CT, Chou HH, Chang TC, Wang TH
Taiwanese journal of obstetrics & gynecology 2013 Jun;52(2):185-91
Taiwanese journal of obstetrics & gynecology 2013 Jun;52(2):185-91
Stress-induced phosphoprotein 1 as a secreted biomarker for human ovarian cancer promotes cancer cell proliferation.
Wang TH, Chao A, Tsai CL, Chang CL, Chen SH, Lee YS, Chen JK, Lin YJ, Chang PY, Wang CJ, Chao AS, Chang SD, Chang TC, Lai CH, Wang HS
Molecular & cellular proteomics : MCP 2010 Sep;9(9):1873-84
Molecular & cellular proteomics : MCP 2010 Sep;9(9):1873-84
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- STIP1 monoclonal antibody (M35), clone 2E11. Western Blot analysis of STIP1 expression in human ovarian cancer.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- STIP1 monoclonal antibody (M35), clone 2E11. Western Blot analysis of STIP1 expression in MCF-7.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of STIP1 expression in transfected 293T cell line by STIP1 monoclonal antibody (M35), clone 2E11.Lane 1: STIP1 transfected lysate (Predicted MW: 62.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged STIP1 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to STIP1 on formalin-fixed paraffin-embedded human ovarian cancer. [antibody concentration 0.75 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- FACS analysis of ES-2 cells stained with STIP1 monoclonal antibody clone 2E11 (Green) and non-stained ES-2 cells (Black) as negative control.
- Validation comment
- Flow Cytometry
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- FACS analysis of A-431 cells stained with STIP1 monoclonal antibody clone 2E11 (Green) and non-stained A-431 cells (Black) as negative control.
- Validation comment
- Flow Cytometry