HPA021794

PRPF4 antibody from Atlas Antibodies
HPRP4, HPRP4P, PRP4, Prp4p, SNRNP60
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021794
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021794, RRID:AB_1855772
Product name
Anti-PRPF4
Provider product page
Atlas Antibodies - HPA021794
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QATKTKAPDDLVAPVVKKPHIYYGSLEEKERERLA
KGESGILGKDGLKAGIEAGNINITSGEVFEIEEHI
SERQAEVLAEFERRKRARQINVSTDDS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -