HPA022248

PRPF4 antibody from Sigma-Aldrich
HPRP4, HPRP4P, PRP4, Prp4p, SNRNP60
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022248
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022248, RRID:AB_1855773
Product name
Anti-PRPF4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022248
Antibody type
Polyclonal
Antigen
U4/U6 small nuclear ribonucleoprotein Prp4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ISYCHFSPNSKMLATACWSGLCKLWSVPDCNLLHT
LRGHNTNVGAIVFHPKSTVSLDPKDVNLASCAADG
SVKLWSLDSDEPVADIE
Storage
-20C
Provider Type Product Number
- No reagents -