HPA015076

SGMS2 antibody from Sigma-Aldrich
MGC26963, SMS2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015076
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015076, RRID:AB_1857298
Product name
Anti-SGMS2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015076
Antibody type
Polyclonal
Antigen
Phosphatidylcholine:ceramide cholinephosphotransferase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IIETAKLEEHLENQPSDPTNTYARPAEPVEEENKN
GNGKPKSLSSGLRKGTKKYPDYIQIAMPTESR
Storage
-20C
Provider Type Product Number
- No reagents -