HPA019364

CROT antibody from Sigma-Aldrich
COT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019364
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019364, RRID:AB_1847173
Product name
Anti-CROT antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019364
Antibody type
Polyclonal
Antigen
Peroxisomal carnitine O-octanoyltransferase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VRWGDKSYNLISFSNGVFGCNCDHAPFDAMIMVNI
SYYVDEKIFQNEGRWKGSEKVRDIPLPEELIFIVD
EKVLNDINQAKAQYLR
Storage
-20C
Provider Type Product Number
- No reagents -