Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184248 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GRIA2 antibody: synthetic peptide directed towards the N terminal of human GRIA2
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
PRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVA
NSFAV TNAFCSQFSR- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Primary structure and functional expression of the AMPA/kainate receptor subunit 2 from human brain.
Sun W, Ferrer-Montiel AV, Montal M
Neuroreport 1994 Jan 12;5(4):441-4
Neuroreport 1994 Jan 12;5(4):441-4
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Immunohistochemistry
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Sample Type: Mouse Gut Tissue Primary Dilution: 20 μg/mL and 4 μg/mL Secondary (Goat Anti-Rabbit Cy3)Dilution: 1:1500