Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA008441 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA008441, RRID:AB_1078983
- Product name
- Anti-GRIA2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
NLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERA
LKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNG
PRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVV
VTTILESPYVMMKKNHEMLEGNERYEGYCVDLA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Identification of differentially expressed genes according to chemosensitivity in advanced ovarian serous adenocarcinomas: expression of GRIA2 predicts better survival
Novel markers for enterochromaffin cells and gastrointestinal neuroendocrine carcinomas
Choi C, Choi J, Park Y, Lee Y, Song S, Sung C, Song T, Kim M, Kim T, Lee J, Kim H, Bae D, Kim B
British Journal of Cancer 2012;107(1):91-99
British Journal of Cancer 2012;107(1):91-99
Novel markers for enterochromaffin cells and gastrointestinal neuroendocrine carcinomas
Leja J, Essaghir A, Essand M, Wester K, öberg K, Tötterman T, Lloyd R, Vasmatzis G, Demoulin J, Giandomenico V
Modern Pathology 2009;22(2):261-272
Modern Pathology 2009;22(2):261-272
No comments: Submit comment
No validations: Submit validation data