HPA008441

GRIA2 antibody from Sigma-Aldrich
GluA2, GLUR2, GLURB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008441
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008441, RRID:AB_1078983
Product name
Anti-GRIA2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008441
Antibody type
Polyclonal
Antigen
Glutamate receptor 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERA
LKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNG
PRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVV
VTTILESPYVMMKKNHEMLEGNERYEGYCVDLA
Storage
-20C
Provider Type Product Number
- No reagents -