HPA019340

WDR31 antibody from Sigma-Aldrich
FLJ35921
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019340
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019340, RRID:AB_1858800
Product name
Anti-WDR31 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019340
Antibody type
Polyclonal
Antigen
WD repeat-containing protein 31 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MLLLRCQLKQAPPQKVSFRFCVVMGKQQSKLKHST
YKYGRPDEIIEERIQTKAFQEYSPAHMDTVSVVAA
LNSDLCVSGGKDKT
Storage
-20C
Provider Type Product Number
- No reagents -