Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002492-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002492-A01, RRID:AB_462502
- Product name
- FSHR polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant FSHR.
- Antigen sequence
CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELR
FVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIE
ADVFSNLPKLHEIRIEKANNLLYINPEAFQNLP- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Follicle-stimulating hormone does not impact male bone mass in vivo or human male osteoclasts in vitro.
Ritter V, Thuering B, Saint Mezard P, Luong-Nguyen NH, Seltenmeyer Y, Junker U, Fournier B, Susa M, Morvan F
Calcified tissue international 2008 May;82(5):383-91
Calcified tissue international 2008 May;82(5):383-91
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- FSHR polyclonal antibody (A01), Lot # 051011JC01 Western Blot analysis of FSHR expression in HepG2 ( Cat # L019V1 ).