H00002492-A01

FSHR antibody from Abnova Corporation
FSHRO, LGR1, ODG1

Antibody data

Product number
H00002492-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002492-A01, RRID:AB_462502
Product name
FSHR polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00002492-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant FSHR.
Antigen sequence
CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELR
FVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIE
ADVFSNLPKLHEIRIEKANNLLYINPEAFQNLP
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -