Antibody data

Product number
ABIN404815
Provider
antibodies-online
Product name
anti-Homeobox C10 (HOXC10) antibody
Provider product page
antibodies-online - ABIN404815
Antibody type
Polyclonal
Antigen
The immunogen for anti-HOXC10 antibody: synthetic peptide directed towards the N terminal of human HOXC10
Reactivity
Human, Mouse, Canine
Host
Rabbit
Antigen sequence
GSDFNCGVMRGCGLAPSLSKRDEGSSPSLALNTYP
SYLSQ LDSWGDPKAA
Vial size
50 µg
Provider Type Product Number
- No reagents -