WH0003225M1

HOXC9 antibody from Sigma-Aldrich
HOX3, HOX3B
ELISA
Recommended by provider

Antibody data

Product number
WH0003225M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0003225M1, RRID:AB_1841993
Product name
Monoclonal Anti-HOXC9 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0003225M1
Antibody type
Monoclonal
Antigen
HOXC9 (AAH53894, a.a. 1-261) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MSATGPISNYYVDSLISHDNEDLLASRFPATGAHP
AAARPSGLVPDCSDFPSCSFAPKPAVFSTSWAPVP
SQSSVVYHPYGPQPHLGADTRYMRTWLEPLSGAVS
FPSFPAGGRHYALKPDAYPGRRADCGPGEGRSYPD
YMYGSPGELRDRAPQTLPSPEADALAGSKHKEEKA
DLDPSNPVANWIHARSTRKKRCPYTKYQTLELEKE
FLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRM
KMKKMNKEKT (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -