Antibody data

Product number
H00003223-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003223-M04, RRID:AB_1576056
Product name
HOXC6 monoclonal antibody (M04), clone 2A4
Provider product page
Abnova Corporation - H00003223-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant HOXC6.
Antigen sequence
PFYSPQENVVFSSSRGPYDYGSNSFYQEKDMLSNC
RQNTLGHNTQTSIAQDFSSEQGRTAPQDQKASIQI
YPWMQRMNSHSGVGYGADRR
Isotype
IgG
Antibody clone number
2A4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -