Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000684-D02 - Provider product page
- Provider
- Abnova Corporation
- Product name
- BST2 MaxPab rabbit polyclonal antibody (D02)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a partial human BST2 protein.
- Antigen sequence
PLIIFTIKANSEACRDGLRAVMECRNVTHLLQQEL
TEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQG
QKKVEELEGEITTLNHKLQDASAEVERLRRENQVL
SVRIADKKYYPSSQDSSSAAAPQLLIVLLGLSALL
Q- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of BST2 expression in transfected 293T cell line (H00000684-T05) by BST2 MaxPab polyclonal antibody.Lane 1: BST2 transfected lysate(15.62 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- BST2 MaxPab rabbit polyclonal antibody. Western Blot analysis of BST2 expression in mouse testis.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of BST2 transfected lysate using anti-BST2 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with BST2 purified MaxPab mouse polyclonal antibody (B03P) (H00000684-B03P).
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol