Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000684-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000684-M02, RRID:AB_1136901
- Product name
- BST2 monoclonal antibody (M02), clone 3H4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant BST2.
- Antigen sequence
PLIIFTIKANSEACRDGLRAVMECRNVTHLLQQEL
TEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQG
QKKVEELEGEITTLNHKLQDASAEVERLRRENQVL
SVRIADKKYYPSSQDSSSAAAPQLLIVLLGLSALL
Q- Isotype
- IgG
- Antibody clone number
- 3H4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Release of filamentous and spherical influenza A virus is not restricted by tetherin.
Bruce EA, Abbink TE, Wise HM, Rollason R, Galao RP, Banting G, Neil SJ, Digard P
The Journal of general virology 2012 May;93(Pt 5):963-9
The Journal of general virology 2012 May;93(Pt 5):963-9
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of BST2 expression in transfected 293T cell line by BST2 monoclonal antibody (M02), clone 3H4.Lane 1: BST2 transfected lysate(19.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged BST2 is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol