Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000684-M15 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000684-M15, RRID:AB_1571792
- Product name
- BST2 monoclonal antibody (M15), clone 2E6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant BST2.
- Antigen sequence
MASTSYDYCRVPMEDGDKRCKLLLGIGILVLLIIV
ILGVPLIIFTIKANSEACRDGLRAVMECRNVTHLL
QQELTEAQKGFQDVEAQAATCNHTVMALMASLDAE
KAQGQKKVEELEGEITTLNHKLQDASAEVERLRRE
NQVLSVRIADKKYYPSSQDSSSAAAPQLLIVLLGL
SALLQ- Isotype
- IgG
- Antibody clone number
- 2E6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Epitope tags beside the N-terminal cytoplasmic tail of human BST-2 alter its intracellular trafficking and HIV-1 restriction.
Purification of eukaryotic tetherin/Vpu proteins and detection of their interaction by ELISA.
Polarity changes in the transmembrane domain core of HIV-1 Vpu inhibits its anti-tetherin activity.
Lv M, Wang J, Zhang J, Zhang B, Wang X, Zhu Y, Zuo T, Liu D, Li X, Wu J, Zhang H, Yu B, Wu H, Zhao X, Kong W, Yu X
PloS one 2014;9(10):e111422
PloS one 2014;9(10):e111422
Purification of eukaryotic tetherin/Vpu proteins and detection of their interaction by ELISA.
Lv M, Zhu Y, Wang J, Zhang H, Wang X, Zuo T, Liu D, Zhang J, Wu J, Kong W, Yu X
Protein expression and purification 2013 Oct;91(2):112-8
Protein expression and purification 2013 Oct;91(2):112-8
Polarity changes in the transmembrane domain core of HIV-1 Vpu inhibits its anti-tetherin activity.
Lv M, Wang J, Wang X, Zuo T, Zhu Y, Kong W, Yu X
PloS one 2011;6(6):e20890
PloS one 2011;6(6):e20890
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- BST2 monoclonal antibody (M15), clone 2E6. Western Blot analysis of BST2 expression in human placenta.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged BST2 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to BST2 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of BST2 transfected lysate using anti-BST2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with BST2 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol