HPA017060

BST2 antibody from Sigma-Aldrich
CD317, tetherin
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017060
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017060, RRID:AB_1845467
Product name
Anti-BST2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017060
Antibody type
Polyclonal
Antigen
Bone marrow stromal antigen 2 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
THLLQQELTEAQKGFQDVEAQAATCNHTVMALMAS
LDAEKAQGQKKVEELEGEITTLNHKLQDASAEVER
LRRENQVLSVRIADKKYYPSSQDSSSAAAPQLLIV
LLG
Storage
-20C
Provider Type Product Number
- No reagents -