HPA017060

BST2 antibody from Atlas Antibodies
CD317, tetherin
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017060
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017060, RRID:AB_1845467
Product name
Anti-BST2
Provider product page
Atlas Antibodies - HPA017060
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
THLLQQELTEAQKGFQDVEAQAATCNHTVMALMAS
LDAEKAQGQKKVEELEGEITTLNHKLQDASAEVER
LRRENQVLSVRIADKKYYPSSQDSSSAAAPQLLIV
LLG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -