H00054107-B02

POLE3 antibody from Abnova Corporation
CHARAC17, CHRAC17, CHRAC2, p17, Ybl1

Antibody data

Product number
H00054107-B02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00054107-B02, RRID:AB_915756
Product name
POLE3 MaxPab mouse polyclonal antibody (B02)
Provider product page
Abnova Corporation - H00054107-B02
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human POLE3 protein.
Antigen sequence
MAERPEDLNLPNAVITRIIKEALPDGVNISKEARS
AISRAASVFVLYATSCANNFAMKGKRKTLNASDVL
SAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQ
KKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQN
EEEEVDN
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -