H00054107-B02P
antibody from Abnova Corporation
Targeting: POLE3
CHARAC17, CHRAC17, CHRAC2, p17, Ybl1
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00054107-B02P - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00054107-B02P, RRID:AB_1578938
- Product name
- POLE3 purified MaxPab mouse polyclonal antibody (B02P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human POLE3 protein.
- Antigen sequence
MAERPEDLNLPNAVITRIIKEALPDGVNISKEARS
AISRAASVFVLYATSCANNFAMKGKRKTLNASDVL
SAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQ
KKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQN
EEEEVDN- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- POLE3 MaxPab polyclonal antibody. Western Blot analysis of POLE3 expression in human liver.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of POLE3 expression in transfected 293T cell line (H00054107-T02) by POLE3 MaxPab polyclonal antibody.Lane 1: POLE3 transfected lysate(16.17 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of purified MaxPab antibody to POLE3 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol