AMAb91427

antibody from Atlas Antibodies

Targeting: SORT1 Gp95, NT3

Antibody data

Submit

Validation data

Product number: AMAb91427 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#AMAb91427, RRID:AB_2732088
Product name: Anti-SORT1
Antibody type: Monoclonal
Reactivity: Human, Mouse
Host: Mouse
Conjugate: Unconjugated
Antigen sequence: LERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQF LRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDF GYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTT NGYRKIPGDKCQGGVNPVREVKD
Epitope: Binds to an epitope located within the peptide sequence CVEQPELKGHDLEFC as determined by overlapping synthetic peptides.
Isotype: IgG
Antibody clone number: CL6526
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SORT1 protein structure - AMAb91427 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cerebral cortex and lymph node tissues using AMAb91427 antibody. Corresponding SORT1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows only weak positivity in a subset of lymphoid cells, as expected.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of mouse cerebral cortex shows strong cytoplasmic positivity in neurons.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of mouse hippocampus shows strong cytoplasmic positivity in both pyramidal neurons and granular cells.