HPA006889

SORT1 antibody from Sigma-Aldrich
Gp95, NT3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006889
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006889, RRID:AB_1080056
Product name
Anti-SORT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006889
Antibody type
Polyclonal
Antigen
Sortilin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQF
LRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDF
GYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTT
NGYRKIPGDKCQGGVNPVREVKD
Storage
-20C
Provider Type Product Number
- No reagents -