Antibody data

Product number
ABIN406547
Provider
antibodies-online
Product name
anti-Chromosome 9 Open Reading Frame 43 (C9orf43) (Middle Region) antibody
Provider product page
antibodies-online - ABIN406547
Antibody type
Polyclonal
Antigen
The immunogen for anti-C9orf43 antibody: synthetic peptide directed towards the middle region of human C9orf43
Description
Affinity Purified
Reactivity
Human, Canine
Host
Rabbit
Antigen sequence
PEAQAARQKKISFNFSEIMASTGWNSELKLLRILQ
DTDDE DEEDQSSGAE
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -