HPA021310

C9orf43 antibody from Sigma-Aldrich
MGC17358
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021310
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021310, RRID:AB_1845825
Product name
Anti-C9orf43 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021310
Antibody type
Polyclonal
Antigen
Uncharacterized protein C9orf43 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PVLNLNETQLPCPEDVRNMVVLWIPEETEIHVSQH
GKKKRKNSAVKSKSFLGLSGNQSAGTRVGTPGMIV
PPPTPVQLSEQFSSDFLPLWAQSEALPQDLLKELL
PGGKQTMLCP
Storage
-20C
Provider Type Product Number
- No reagents -