HPA024199

NXT2 antibody from Sigma-Aldrich
P15-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024199
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024199, RRID:AB_1854738
Product name
Anti-NXT2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024199
Antibody type
Polyclonal
Antigen
NTF2-related export protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KRRRALTRLYLDKATLIWNGNAVSGLDALNNFFDT
LPSSEFQVNMLDCQPVHEQATQSQTTVLVVTSGTV
KFDGNKQHFFNQNFLLTAQSTPNNTVWKIASDCFR
FQDWSSS
Storage
-20C
Provider Type Product Number
- No reagents -