HPA007272

KRT7 antibody from Sigma-Aldrich
CK7, K2C7, K7, SCL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007272
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007272, RRID:AB_1079181
Product name
Anti-KRT7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007272
Antibody type
Polyclonal
Antigen
Keratin, type II cytoskeletal 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETK
WTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQV
DGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAEN
EFVVLKKDVD
Storage
-20C
Provider Type Product Number
- No reagents -