Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002752-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002752-M02, RRID:AB_509393
- Product name
- GLUL monoclonal antibody (M02), clone 3B6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GLUL.
- Antigen sequence
IEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSN
INDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPS
ANCDPFSVTEALIRTCLLNETGDEPFQYKN- Isotype
- IgG
- Antibody clone number
- 3B6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Optimisation of the quantification of glutamine synthetase and myelin basic protein in cerebrospinal fluid by a combined acidification and neutralisation protocol.
Herbert MK, Kuiperij HB, Verbeek MM
Journal of immunological methods 2012 Jul 31;381(1-2):1-8
Journal of immunological methods 2012 Jul 31;381(1-2):1-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- GLUL monoclonal antibody (M02), clone 3B6 Western Blot analysis of GLUL expression in Jurkat ( Cat # L017V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- GLUL monoclonal antibody (M02), clone 3B6. Western Blot analysis of GLUL expression in Raw 264.7 ( Cat # L024V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of GLUL expression in transfected 293T cell line by GLUL monoclonal antibody (M02), clone 3B6.Lane 1: GLUL transfected lysate(42.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged GLUL is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol