Antibody data

Product number
H00002752-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002752-M01A, RRID:AB_1204409
Product name
GLUL monoclonal antibody (M01A), clone 2B12
Provider product page
Abnova Corporation - H00002752-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant GLUL.
Antigen sequence
MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDG
TGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQS
EGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYN
RRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLM
GTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDI
VEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCE
GISMGDHLWVARFILHRVCEDFGVIATFDPKPIPG
NWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKR
HQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAG
VANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFS
VTEALIRTCLLNETGDEPFQYKN
Isotype
IgG
Antibody clone number
2B12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -