HPA007316

GLUL antibody from Sigma-Aldrich
GLNS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007316
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007316, RRID:AB_1078981
Product name
Anti-GLUL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007316
Antibody type
Polyclonal
Antigen
Glutamine synthetase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVF
KYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEY
TLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYG
RDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIG
P
Storage
-20C
Provider Type Product Number
- No reagents -