HPA007342

TCTA antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007342
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007342, RRID:AB_2202399
Product name
Anti-TCTA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007342
Antibody type
Polyclonal
Antigen
T-cell leukemia translocation-altered gene protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AESWSGQALQALPATVLGALGSEFLREWEAQDMRV
TLFKL
Storage
-20C
Provider Type Product Number
- No reagents -