ABIN786397

HARS1 antibody from antibodies-online
HARS, HisRS, USH3B

Antibody data

Product number
ABIN786397
Provider
antibodies-online
Product name
anti-Histidyl TRNA Synthetase (HARS) (N-Term) antibody
Provider product page
antibodies-online - ABIN786397
Antibody type
Polyclonal
Antigen
The immunogen for anti-HARS antibody: synthetic peptide directed towards the N terminal of human HARS
Reactivity
Human
Host
Rabbit
Antigen sequence
FVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHG
AEVID TPVFELKETL
Vial size
50 µg
Provider Type Product Number
- No reagents -