Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010926-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010926-M01, RRID:AB_529968
- Product name
- DBF4 monoclonal antibody (M01), clone 6G9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant DBF4.
- Antigen sequence
NSGAMRIHSKGHFQGGIQVKNEKNRPSLKSLKTDN
RPEKSKCKPLWGKVFYLDLPSVTISEKLQKDIKDL
GGRVEEFLSKDISYLISNKKEAKFAQT- Isotype
- IgG
- Antibody clone number
- 6G9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Transcriptional co-activator LEDGF interacts with Cdc7-activator of S-phase kinase (ASK) and stimulates its enzymatic activity.
Hughes S, Jenkins V, Dar MJ, Engelman A, Cherepanov P
The Journal of biological chemistry 2010 Jan 1;285(1):541-54
The Journal of biological chemistry 2010 Jan 1;285(1):541-54
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of DBF4 expression in transfected 293T cell line by DBF4 monoclonal antibody (M01), clone 6G9.Lane 1: DBF4 transfected lysate(76.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged DBF4 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to DBF4 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol