HPA026652

CCDC88B antibody from Atlas Antibodies
BRLZ, CCDC88, FLJ00354, FLJ37970, GIPIE, HkRP3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026652
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026652, RRID:AB_1846168
Product name
Anti-CCDC88B
Provider product page
Atlas Antibodies - HPA026652
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GLRQEGPEHKPGPSEPSSVQLEEQEGPNQGLDLAT
GQAEAREHDQRLEGTVRDPAWQKPQQKSEGALEVQ
VWEGPIPGESLASGVAEQEALREEVAQLRRKAEAL
GDELEAQARKLEAQNTEAARLSKELAQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -