HPA019616

LPAR2 antibody from Sigma-Aldrich
EDG-4, EDG4, LPA2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019616
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019616, RRID:AB_1847988
Product name
Anti-LPAR2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019616
Antibody type
Polyclonal
Antigen
Lysophosphatidic acid receptor 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVY
SCRDAEMRRTFRRLLCCACLRQSTRESVHYTSSAQ
GGASTRIMLPENGHPLMDSTL
Storage
-20C
Provider Type Product Number
- No reagents -