HPA026707

ZNF804B antibody from Sigma-Aldrich
FLJ32110
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026707
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026707, RRID:AB_1859458
Product name
Anti-ZNF804B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026707
Antibody type
Polyclonal
Antigen
Zinc finger protein 804B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YQYPKPKTMIANPDWEKFQRKYNLDYSDSEPNKSE
YTFSANDLEMKNPKVPLYLNTSLKDCAGKNNSSEN
KLKEASRAHWQGCRKAVLNDIDEDLSFPSYISRFK
KHKLIPCSPHLEFEDER
Storage
-20C
Provider Type Product Number
- No reagents -