Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002806-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002806-A01, RRID:AB_463710
- Product name
- GOT2 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant GOT2.
- Antigen sequence
LNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKE
GSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSI
YMTKDGRISVAGVTSSNVGYLAHAIHQVTK- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Food and Chemical Toxicology, 2011, 'Possible role of cysteine-S-conjugate β-lyase in species differences in cisplatin nephrotoxicity', R. Katayama, S. Nagata, H. Iida, N. Yamagishi, T. Yamashita, K. Furuhama.
N-terminal mutant huntingtin associates with mitochondria and impairs mitochondrial trafficking.
Cooper AJ, Hanigan MH
Food and chemical toxicology : an international journal published for the British Industrial Biological Research Association 2011 Dec;49(12):3279-80
Food and chemical toxicology : an international journal published for the British Industrial Biological Research Association 2011 Dec;49(12):3279-80
N-terminal mutant huntingtin associates with mitochondria and impairs mitochondrial trafficking.
Orr AL, Li S, Wang CE, Li H, Wang J, Rong J, Xu X, Mastroberardino PG, Greenamyre JT, Li XJ
The Journal of neuroscience : the official journal of the Society for Neuroscience 2008 Mar 12;28(11):2783-92
The Journal of neuroscience : the official journal of the Society for Neuroscience 2008 Mar 12;28(11):2783-92
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- GOT2 polyclonal antibody (A01), Lot # FHC0061120QCS1. Western Blot analysis of GOT2 expression in Raw 264.7.