ABIN405573

GOT2 antibody from antibodies-online
KAT4, KATIV, KYAT4, mitAAT

Antibody data

Product number
ABIN405573
Provider
antibodies-online
Product name
anti-Glutamic-Oxaloacetic Transaminase 2, Mitochondrial (Aspartate Aminotransferase 2) (GOT2) (N-Term) antibody
Provider product page
antibodies-online - ABIN405573
Antibody type
Polyclonal
Antigen
The immunogen for anti-GOT2 antibody: synthetic peptide directed towards the N terminal of human GOT2
Description
Affinity Purified
Reactivity
Human, Mouse, Rat
Host
Rabbit
Antigen sequence
VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDD
NGKPY VLPSVRKAEA
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -