Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405573 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Glutamic-Oxaloacetic Transaminase 2, Mitochondrial (Aspartate Aminotransferase 2) (GOT2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GOT2 antibody: synthetic peptide directed towards the N terminal of human GOT2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDD
NGKPY VLPSVRKAEA- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Protection against myocardial ischemia-reperfusion injury at onset of type 2 diabetes in Zucker diabetic fatty rats is associated with altered glucose oxidation.
Association study of GOT2 genetic polymorphisms and schizophrenia.
Povlsen JA, Løfgren B, Dalgas C, Birkler RI, Johannsen M, Støttrup NB, Bøtker HE
PloS one 2013;8(5):e64093
PloS one 2013;8(5):e64093
Association study of GOT2 genetic polymorphisms and schizophrenia.
Tsai SJ, Hong CJ, Liou YJ, Liao DL
Psychiatric genetics 2007 Oct;17(5):314
Psychiatric genetics 2007 Oct;17(5):314
No comments: Submit comment
No validations: Submit validation data