HPA018139

GOT2 antibody from Sigma-Aldrich
KAT4, KATIV, mitAAT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018139
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018139, RRID:AB_1849903
Product name
Anti-GOT2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018139
Antibody type
Polyclonal
Antigen
Aspartate aminotransferase, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMG
LYGERVGAFTMVCKDADEAKRVESQLKILIRPMYS
NPPLNGARIAAAILNTPDLRKQWLQEVKGMADRII
GMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLK
PEQVER
Storage
-20C
Provider Type Product Number
- No reagents -