HPA006903

SPINT1 antibody from Sigma-Aldrich
HAI, MANSC2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006903
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006903, RRID:AB_1079038
Product name
Anti-SPINT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006903
Antibody type
Polyclonal
Antigen
Kunitz-type protease inhibitor 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ACFLINCLYEQNFVCKFAPREGFINYLTREVYRSY
RQLRTQGFGGSGIPKAWAGIDLKVQPQEPLVLKDV
ENTDWRLLRGDTDVRVERKDPNQVELWGLKEGTYL
FQLTVTSSDHP
Storage
-20C
Provider Type Product Number
- No reagents -