HPA016051

TM6SF1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016051
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016051, RRID:AB_2203924
Product name
Anti-TM6SF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016051
Antibody type
Polyclonal
Antigen
Transmembrane 6 superfamily member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PGCSWMPDITLIHAGGLAQAQFSHIGASLHARTAY
VYRVPEEAK
Storage
-20C
Provider Type Product Number
- No reagents -