Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005153-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005153-M01, RRID:AB_509189
- Product name
- PDE1B monoclonal antibody (M01), clone 5B6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PDE1B.
- Antigen sequence
TDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEV
GDPNPDVVSFRSTWVKRIQENKQKWKERAASGITN
QMSIDELSPCEEEAPPSPAEDEHNQNGNLD- Isotype
- IgG
- Antibody clone number
- 5B6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Distinct metabolism of cyclic adenosine monophosphate in regulatory and helper CD4+ T cells.
Bazhin AV, Kahnert S, Kimpfler S, Schadendorf D, Umansky V
Molecular immunology 2010 Jan;47(4):678-84
Molecular immunology 2010 Jan;47(4):678-84
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PDE1B is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol